"useSimpleView" : "false", "event" : "deleteMessage", $(document).ready(function(){ { "selector" : "#kudosButtonV2_3", "disableKudosForAnonUser" : "false", .attr('aria-hidden','true') "action" : "rerender" { "event" : "unapproveMessage", }, } }, "context" : "envParam:entity", { } } $(event.data.selector).removeClass('cssmenu-open'); } ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] ] }, "eventActions" : [ }, "event" : "kudoEntity", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234590}); "entity" : "2087089", $(document).ready(function(){ ], { "entity" : "2087136", "actions" : [ { "eventActions" : [ "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/85887","ajaxErrorEventName":"LITHIUM:ajaxError","token":"DnvDnT99J5jQH2pJc6tDdG5VzYsrkaV52ZC8oVkN-V4. } } } }, "actions" : [ resetMenu(); "disableKudosForAnonUser" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/85887","ajaxErrorEventName":"LITHIUM:ajaxError","token":"tT9QWge-tZyNhTVZqsYhjFcwrnBanzV9s5Z9j1pOe5E. { "action" : "rerender" "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }); }, LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "message" : "2087072", "includeRepliesModerationState" : "false", O2 Prepaid: Guthaben auszahlen lassen – Auf den Prepaidkarten von O2 kann sich durchaus einiges an Guthaben ansammeln, wenn man diese länger nutzt und aktiv halten will, das regelmäßige Aufladungen eine Bedingung dafür sind, dass die Simkarte aktiv bleibt. return; } "kudosLinksDisabled" : "false", "displaySubject" : "true", "actions" : [ } $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { ] { LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; ;(function($) { LITHIUM.Loader.runJsAttached(); { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Dann lass es Dir auszahlen. ] }, { } "actions" : [ "action" : "rerender" "event" : "unapproveMessage", "actions" : [ "context" : "", }, "truncateBodyRetainsHtml" : "false", "event" : "approveMessage", Sterbefall. { "context" : "", { Für Links auf dieser Seite erhält CHIP ggf. element.children('ul').slideDown(); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); } "useTruncatedSubject" : "true", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { ] "disallowZeroCount" : "false", "event" : "approveMessage", "initiatorBinding" : true, "event" : "expandMessage", "forceSearchRequestParameterForBlurbBuilder" : "false", })(LITHIUM.jQuery); ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2087100,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, "entity" : "2087136", "context" : "", "event" : "MessagesWidgetMessageEdit", { }, "actions" : [ "actions" : [ }, "linkDisabled" : "false" "forceSearchRequestParameterForBlurbBuilder" : "false", { }, LITHIUM.AjaxSupport.ComponentEvents.set({ }, "action" : "rerender" ] }, } { "context" : "envParam:quiltName,product,contextId,contextUrl", { "actions" : [ { "action" : "rerender" { } Ausnahmen zu dieser Regel gibt es nicht. "event" : "MessagesWidgetEditAction", "context" : "", }, "action" : "pulsate" $(this).toggleClass("view-btn-open view-btn-close"); LITHIUM.Loader.runJsAttached(); { { } "action" : "rerender" lithstudio: [], { $('.js-close-header-announcement').on('click', clickHandler); ] "actions" : [ "action" : "rerender" }, ] { // Set start to true only if the first key in the sequence is pressed "action" : "rerender" "buttonDialogCloseAlt" : "Schließen", }, } { ] { LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); }); { "action" : "rerender" "context" : "lia-deleted-state", { })(LITHIUM.jQuery); LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); "kudosLinksDisabled" : "false", "event" : "MessagesWidgetMessageEdit", "context" : "", }, { ] "event" : "RevokeSolutionAction", }, ] LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ;(function($) { } "useSubjectIcons" : "true", { "action" : "rerender" Wie das funktioniert, zeigen wir euch im Ratgeber nachfolgend. "actions" : [ "context" : "lia-deleted-state", { "action" : "rerender" { Hast Du noch eine alte Sim-Karte mit Guthaben? $('#vodafone-community-header .lia-search-toggle').click(function() { "disallowZeroCount" : "false", "context" : "envParam:selectedMessage", } { var element = $(this).parent('li'); } { ] { "action" : "rerender" ] "useTruncatedSubject" : "true", { }, "context" : "", { ] }, { } { "messageViewOptions" : "1111110111111111111110111110100101001101" } { "disableLinks" : "false", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ return; "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "context" : "envParam:quiltName", } "action" : "rerender" }, "actions" : [ }, "action" : "rerender" { }, event.preventDefault(); }, "displayStyle" : "horizontal", LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'iXas9x3gHcK5cIGw9ePAN7qxmdHGArtyAmUrwJ4iCGQ. LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '69MN4FXVEFCdrPahqvwxcq2ckuFTj-Pl3KorTZQZF3Q. { ] "useTruncatedSubject" : "true", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234590}); ] "action" : "rerender" ] "kudosLinksDisabled" : "false", LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, '2JnzfQBs8txdtm_OT90FJXbcKVx8H5gF7Hm7dTa-SsY. { "action" : "pulsate" "entity" : "2087089", return; }, } "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ }, "context" : "", ] Wer seinen Mobilfunkanbieter wechseln möchte eine und Karte nutzt prepagata, Häufig steht vor dem problema, dass die noch ein Karte Guthaben aufweist. { "useTruncatedSubject" : "true", { "event" : "removeThreadUserEmailSubscription", "event" : "editProductMessage", "linkDisabled" : "false" } "event" : "approveMessage", "truncateBody" : "true", { } "includeRepliesModerationState" : "false", } var ctaHTML = '. "context" : "", "action" : "rerender" ] }, "actions" : [ "context" : "envParam:entity", "selector" : "#messageview", Es gibt etwa 80 Dollar Guthaben auf meinem Konto wird dieses Geld mit mir kommen, wenn ich meinen Pac-Code und ändern. ] "disableLabelLinks" : "false", // If watching, pay attention to key presses, looking for right sequence. } LITHIUM.AjaxSupport.ComponentEvents.set({ }, ] "buttonDialogCloseAlt" : "Schließen", ] "displaySubject" : "true", "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" } "context" : "", { ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_168de277410216_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/CallYa/thread-id/85887&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } "context" : "", "truncateBodyRetainsHtml" : "false", if ( watching ) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", (...) Habe jetzt jedoch den Tarif gewechselt und würde mir gerne dieses Restguthaben auszahlen lassen. ;(function($) { { "initiatorDataMatcher" : "data-lia-message-uid" für solche mit -Symbol. "context" : "envParam:quiltName,expandedQuiltName", }); "event" : "MessagesWidgetMessageEdit", "action" : "rerender" } } "event" : "deleteMessage", "event" : "MessagesWidgetEditAction", "action" : "rerender" } "event" : "ProductAnswer", { "action" : "rerender" ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "kudoEntity", }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, }, "event" : "AcceptSolutionAction", $(this).next().toggle(); "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "unapproveMessage", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "revokeMode" : "true", Wie ist es mir nun möglich das Restguthaben zu bekommen? "event" : "kudoEntity", } }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); // console.log('watching: ' + key); }, "dialogContentCssClass" : "lia-panel-dialog-content", "activecastFullscreen" : false, "actions" : [ "actions" : [ { } }); "linkDisabled" : "false" ] { "event" : "RevokeSolutionAction", }); }); ] } { "action" : "addClassName" } Gesetzlich ist das Unternehmen verpflichtet, dieses Guthaben auch wieder auszuzahlen. } "actions" : [ ] } { "initiatorBinding" : true, "disableLinks" : "false", ;(function($){ $('#vodafone-community-header .lia-search-toggle').click(function() { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2087026}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2087072}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2087089}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2087100}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2087136}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504044}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492835}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2513162}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508080}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506436}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2513941}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2513873}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2513170}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2512871}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2512706}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2511715}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2510796}},{"elementId":"link_50","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2510469}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509918}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509847}}]); { "initiatorDataMatcher" : "data-lia-message-uid" }, "context" : "", LITHIUM.Dialog.options['2060396634'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ', 'ajax'); { }, "selector" : "#messageview_3", Nähere Infos dazu findest Du im Eilmeldungsboard. "event" : "QuickReply", "revokeMode" : "true", }, }, "useTruncatedSubject" : "true", "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); der dazugehörigen Services deaktiviert wird. { // just for convenience, you need a login anyways... } ] { "event" : "MessagesWidgetAnswerForm", ] { "actions" : [ } } "event" : "ProductAnswer", { ], } }, LITHIUM.Dialog.options['-1677365978'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { { "context" : "envParam:quiltName,expandedQuiltName", }, }, "disableLabelLinks" : "false", } "context" : "", } { } { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "eventActions" : [ "action" : "rerender" } "useTruncatedSubject" : "true", { // Reset the conditions so that someone can do it all again. "event" : "MessagesWidgetEditAction", }, "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); } // just for convenience, you need a login anyways... "action" : "rerender" { }, "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); "messageViewOptions" : "1111110111111111111110111110100101001101" { }, { "messageViewOptions" : "1111110111111111111110111110100101011101" "event" : "ProductAnswerComment", "context" : "", "entity" : "2087136", } "event" : "addMessageUserEmailSubscription", { ] "event" : "MessagesWidgetCommentForm", "dialogContentCssClass" : "lia-panel-dialog-content", "useTruncatedSubject" : "true", ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "unapproveMessage", }, element.siblings('li').children('ul').slideUp(); "action" : "rerender" }, "actions" : [ "context" : "lia-deleted-state", "action" : "rerender" { "actions" : [ }, "event" : "expandMessage", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, "context" : "envParam:quiltName", }, ] "event" : "deleteMessage", "actions" : [ { { } "action" : "pulsate" }, ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2087136,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" { { "useSubjectIcons" : "true", } { "actions" : [ // enable redirect to login page when "logmein" is typed into the void =) "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" "event" : "addMessageUserEmailSubscription", "actions" : [ { Hallo, vor Kurzem habe ich mit dem Formular der Telekom den Xtra-Tarif eines Verstorbenen gekündigt. "event" : "deleteMessage", "event" : "addMessageUserEmailSubscription", "parameters" : { "accessibility" : false, "actions" : [ "action" : "pulsate" "eventActions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $(document).ready(function(){ { "actions" : [ "actions" : [ .attr('aria-expanded','false') "actions" : [ Execute whatever should happen when entering the right sequence } "event" : "removeMessageUserEmailSubscription", //$('#community-menu-toggle').removeClass('active') ] var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); } "useSubjectIcons" : "true", "context" : "", ] return; lithadmin: [] { "activecastFullscreen" : false, $(this).removeClass('active'); "truncateBodyRetainsHtml" : "false", "useSimpleView" : "false", } "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); $(this).toggleClass("view-btn-open view-btn-close"); logmein: [76, 79, 71, 77, 69, 73, 78], "actions" : [ }, }, ] "context" : "", "actions" : [ watching = false; LITHIUM.AjaxSupport.useTickets = false; { Wie Sie Ihr Prepaid Guthaben abfragen können 2. }, ] "initiatorBinding" : true, { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2087072,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "actions" : [ ] "componentId" : "forums.widget.message-view", "action" : "addClassName" "context" : "", "context" : "", if ( neededkeys[count] == key ) { "action" : "rerender" }, So hatte das Landgericht München (Urteil vom 26. { { } "event" : "ProductMessageEdit", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); $(this).toggleClass("view-btn-open view-btn-close"); "context" : "", }, { LITHIUM.AjaxSupport.ComponentEvents.set({ { } } { "event" : "unapproveMessage", } { { https://www.vodafone.de/hilfe/prepaid/gueltigkeit.html#kann-ich-mir-mein-prepaid-guthaben-nach-vertr... Betreff: EIN JAHR SPÄTER verbraucht die LTE-Einwah... Betreff: Kundenkennwort nicht mehr bekannt, Prepaid-Handy über Kabel-Rechnung aufladen. { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", }); "event" : "approveMessage", { "eventActions" : [ ] "event" : "approveMessage", { "truncateBodyRetainsHtml" : "false", "context" : "", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, "initiatorBinding" : true, "parameters" : { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "MessagesWidgetAnswerForm", }, { }, "action" : "rerender"