"actions" : [ } { "actions" : [ } "context" : "", ] } } "action" : "rerender" } } { $('div[class*="-menu-btn"]').removeClass('active'); } "actions" : [ "actions" : [ "showCountOnly" : "false", "displaySubject" : "true", { "truncateBody" : "true", "displayStyle" : "horizontal", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/242625","ajaxErrorEventName":"LITHIUM:ajaxError","token":"NlDzJ7r7AUoXCd6fr2hTTLTuBUgKlRi41ev86auCfiM. "context" : "envParam:quiltName,message", $(this).next().toggle(); "event" : "ProductAnswer", ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "envParam:selectedMessage", "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "event" : "removeMessageUserEmailSubscription", "event" : "MessagesWidgetAnswerForm", }, } } "event" : "ProductMessageEdit", "eventActions" : [ "action" : "rerender" } "action" : "rerender" "context" : "", "event" : "kudoEntity", "disableLinks" : "false", }); ] ] LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } { "event" : "deleteMessage", } "displayStyle" : "horizontal", "actions" : [ { Welche Vodafone Verträge kann ich per E-Mail kündigen? { "eventActions" : [ "disableLinks" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "AcceptSolutionAction", "event" : "MessagesWidgetCommentForm", } "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { "context" : "lia-deleted-state", "action" : "rerender" ] "actions" : [ { }); "actions" : [ { LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.Loader.runJsAttached(); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); ] ] }, ] "initiatorDataMatcher" : "data-lia-message-uid" } "actions" : [ "eventActions" : [ "actions" : [ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "selector" : "#messageview_1", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:refresh_attachment_statuses","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#attachments_0_68831eb1f6d098","action":"refresh_attachment_statuses","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.attachments_0:refresh_attachment_statuses?t:ac=board-id/Archiv_Mobilfunk/thread-id/242625&t:cp=messages/contributions/messageviewparameterscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"OsbsztbLGWWBoa3AhqYRubL2ebwZQV045PMCLjw_PCc. "action" : "rerender" return; "eventActions" : [ $('.community-menu').removeClass('active') "action" : "rerender" "context" : "", } }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "truncateBody" : "true", "action" : "rerender" "actions" : [ { }, "event" : "MessagesWidgetCommentForm", "context" : "envParam:quiltName,message", watching = false; "action" : "rerender" "context" : "", }, var neededkeys = [76, 79, 71, 77, 69, 73, 78]; ;(function($) { ] "context" : "envParam:quiltName,product,contextId,contextUrl", ] var count = 0; "event" : "addThreadUserEmailSubscription", }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" "useSubjectIcons" : "true", { Kündigung Vertrag Vodafone LTE Zuhause + Telefon, < Kd.-Nr. "actions" : [ "context" : "", } "actions" : [ "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "action" : "pulsate" "actions" : [ "truncateBody" : "true", ] } "useCountToKudo" : "false", "selector" : "#kudosButtonV2_4", "action" : "rerender" { "actions" : [ "actions" : [ "kudosLinksDisabled" : "false", { { "componentId" : "forums.widget.message-view", LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "removeMessageUserEmailSubscription", "event" : "approveMessage", ] } "triggerSelector" : ".lia-panel-dialog-trigger-event-click", ] "context" : "envParam:quiltName,product,contextId,contextUrl", }, "eventActions" : [ ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", return; ] }, } var cookieDomain = 'forum.vodafone.de'; "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] }, { Ein Versuch, die gekündigte Partnerkarte zu MeinVodafone hinzuzufügen wurde mit einem Fehler quittiert: Fügst du die Kundennummer mit Kundenkennwort in Mein Vodafone hinzu? "event" : "addMessageUserEmailSubscription", }, "action" : "rerender" "actions" : [ "event" : "unapproveMessage", $(document).ready(function(){ })(LITHIUM.jQuery); $(document).ready(function(){ "useCountToKudo" : "false", "action" : "pulsate" ] "context" : "envParam:quiltName,message", "action" : "rerender" "action" : "rerender" Ein Tarifwechsel ist im Rahmen eines Upgrades, d.h. eines Wechsel des aktuellen Tarifs auf einen höherwertigeren Tarif, jederzeit innerhalb der Mindestvertragslaufzeit möglich. "initiatorDataMatcher" : "data-lia-message-uid" { "}); }, ] "disableKudosForAnonUser" : "false", "actions" : [ "event" : "MessagesWidgetAnswerForm", "context" : "", "context" : "", }, } //$(window).scroll(function() { } "truncateBody" : "true", "kudosable" : "true", $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() "disableLinks" : "false", "action" : "rerender" "context" : "", { "action" : "rerender" } "selector" : "#messageview_3", "context" : "", { }); } "event" : "MessagesWidgetEditCommentForm", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "useSubjectIcons" : "true", "context" : "envParam:feedbackData", LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "componentId" : "forums.widget.message-view", "displaySubject" : "true", count = 0; { ], "parameters" : { "useTruncatedSubject" : "true", "action" : "rerender" } } "eventActions" : [ "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "event" : "ProductAnswer", "action" : "rerender" // just for convenience, you need a login anyways... "action" : "rerender" ] } "action" : "pulsate" "useTruncatedSubject" : "true", { ] ] per Post oder Fax, von ihren Kunden verlangen. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); }); { var notifCount = 0; ] { { { { { ] } ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "actions" : [ }, ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] $('#node-menu li.has-sub>a').on('click', function(){ LITHIUM.Auth.CHECK_SESSION_TOKEN = '4-HxcQNwe-xTmdAsGy3Jg964bS99Vkn-Q0SOtD98y-I. "context" : "", }, "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" "event" : "ProductAnswerComment", } } { }, }, "revokeMode" : "true", "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1969785 .lia-rating-control-passive', '#form_5'); { { "useCountToKudo" : "false", }, "actions" : [ "disableLabelLinks" : "false", // Reset the conditions so that someone can do it all again. } }, "truncateBodyRetainsHtml" : "false", "actions" : [ { "actions" : [ element.siblings('li').children('ul').slideUp(); "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1969785,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } }); }, "initiatorBinding" : true, ] { "message" : "1969785", Bist du sicher, dass du fortfahren möchtest? "useTruncatedSubject" : "true", "actions" : [ } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:quiltName", if ( neededkeys[count] == key ) { "context" : "", "initiatorDataMatcher" : "data-lia-message-uid" $(this).toggleClass("view-btn-open view-btn-close"); LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'g-bLoJGUTbL13Ntf4M_OAut29Vmie_T0ZQwm-Y-ytL4. "event" : "ProductAnswerComment", { }, ], }, "displaySubject" : "true", { ] { }, { "actions" : [ "action" : "pulsate" }, "event" : "ProductMessageEdit", }, } ] "disableKudosForAnonUser" : "false", "action" : "addClassName" ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); Du findest hier alles zum Thema Kündigung. "selector" : "#kudosButtonV2_5", { { var watching = false; LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); }, "event" : "MessagesWidgetCommentForm", "context" : "", LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); Vodafone Vertrag vorzeitig kündigen – das sind eure Rechte Generell ist Vodafone sehr streng, wenn es darum geht einen Vertrag vorzeitig zu kündigen. var ctaHTML = '. "context" : "envParam:quiltName", { } "action" : "pulsate" "action" : "rerender" "context" : "", "}); { "accessibility" : false, }, { "context" : "envParam:quiltName,expandedQuiltName", { Bist du sicher, dass du fortfahren möchtest? // We made it! "event" : "expandMessage", "actions" : [ "event" : "kudoEntity", { }, ] "event" : "QuickReply", }, ] } ] } $(document).ready(function(){ "event" : "deleteMessage", } ] }, { "initiatorBinding" : true, })(LITHIUM.jQuery); }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); { { "message" : "1969785", { LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "action" : "rerender" ], "context" : "", { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1969785 .lia-rating-control-passive', '#form_5'); { { "action" : "pulsate" Du zahlst bis zum Ende Deines Vodafone-Vertrags bei Deinem neuen Anbieter und bei uns. "action" : "rerender" "disallowZeroCount" : "false", "actions" : [ "action" : "rerender" "displayStyle" : "horizontal", "showCountOnly" : "false", "kudosLinksDisabled" : "false", { { { "context" : "", { "context" : "envParam:quiltName", Bist du sicher, dass du fortfahren möchtest? "message" : "1969785", "context" : "", "actions" : [ ] "initiatorBinding" : true, "actions" : [ }, { "action" : "pulsate" "action" : "pulsate" } { { { } "action" : "rerender" ] ] der Rufnummern-Mitnahme - wir kündigen Deinen alten Vertrag. "event" : "addMessageUserEmailSubscription", ] "activecastFullscreen" : false, }, "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "actions" : [ ] LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); count = 0; "event" : "expandMessage", { "event" : "RevokeSolutionAction", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" "selector" : "#kudosButtonV2_3", { { ] "disallowZeroCount" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "}); } "event" : "QuickReply", { "context" : "envParam:quiltName,expandedQuiltName", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "useSubjectIcons" : "true", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1969612 .lia-rating-control-passive', '#form_2'); } }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "MessagesWidgetEditAction", "actions" : [ }, "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "lia-deleted-state", "event" : "MessagesWidgetAnswerForm", }, }); } { }, { { } } "event" : "MessagesWidgetCommentForm", } "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, { ] "actions" : [ ] "event" : "MessagesWidgetEditAction", "actions" : [ { if ( neededkeys[count] == key ) { "context" : "envParam:feedbackData", } "context" : "", "context" : "lia-deleted-state", "context" : "", } "context" : "", Edit: @henrykf  Betreff zum besseren Verständnis angepasst. ] "parameters" : { "actions" : [ watching = true; "kudosLinksDisabled" : "false", "action" : "rerender" } ] ] }, // enable redirect to login page when "logmein" is typed into the void =) "displaySubject" : "true", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); "event" : "removeThreadUserEmailSubscription", } { { "event" : "approveMessage", "context" : "", "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", Möchten Sie Ihren Handy-Vertrag bei Vodafone kündigen, gibt es ein paar Dinge zu beachten. { "kudosable" : "true", "actions" : [ var handleOpen = function(event) { "actions" : [ "triggerEvent" : "click", }); In der Regel läuft dein Vertrag bei Vodafone über einen Zeitraum von zwei Jahren und kann mit einer dreimonatigen Kündigungsfrist beendet werden. "action" : "rerender" } "action" : "rerender" "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "parameters" : { var keycodes = { // console.log(key); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); } "action" : "rerender" und/oder Kundennummer. "event" : "MessagesWidgetAnswerForm", }, { "linkDisabled" : "false" "actions" : [ }, }, "truncateBodyRetainsHtml" : "false", "actions" : [ "context" : "", } "event" : "MessagesWidgetCommentForm", { "action" : "rerender" "action" : "rerender" $(document).ready(function(){ }, ;(function($) { "displaySubject" : "true", "event" : "removeThreadUserEmailSubscription", { lithadmin: [] ] } "linkDisabled" : "false" "event" : "deleteMessage", { "useSimpleView" : "false", "displaySubject" : "true", { "action" : "rerender" "disableLinks" : "false", }, Manchmal wechseln sie Ihren Vertrag auf eine Basisversion, die kostenlos ist. ] "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", { { ], "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "MessagesWidgetEditAnswerForm", { "disableKudosForAnonUser" : "false", }, "context" : "envParam:entity", ] ] //if(height > 430) { } LITHIUM.AjaxSupport.ComponentEvents.set({ "componentId" : "kudos.widget.button", "actions" : [ { }, { "event" : "addMessageUserEmailSubscription", }); "event" : "AcceptSolutionAction", "disableLabelLinks" : "false", "action" : "rerender" { "actions" : [ "event" : "deleteMessage", } "useCountToKudo" : "false", { } "actions" : [ }, }, { { "}); { }, "context" : "envParam:feedbackData", "defaultAriaLabel" : "", { } "parameters" : { "event" : "approveMessage", "actions" : [ "event" : "removeMessageUserEmailSubscription", "event" : "editProductMessage", "forceSearchRequestParameterForBlurbBuilder" : "false", }, { ;(function($) { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "kudosable" : "true", "action" : "rerender" //}); "selector" : "#messageview_4", } "event" : "RevokeSolutionAction", } // If watching, pay attention to key presses, looking for right sequence. { } "buttonDialogCloseAlt" : "Schließen", }, "actions" : [ "context" : "lia-deleted-state", "event" : "MessagesWidgetEditCommentForm", "componentId" : "kudos.widget.button", "event" : "MessagesWidgetEditAnswerForm", { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); ] // console.log('watching: ' + key); "action" : "rerender" }, "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "addThreadUserEmailSubscription", "event" : "kudoEntity", }, { "context" : "envParam:selectedMessage", Bist du sicher, dass du fortfahren möchtest? LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/242625","ajaxErrorEventName":"LITHIUM:ajaxError","token":"fuzlzrtAf_-vSZijuLbCMyWouwYIGqcy679TPgcV_ts. ] } { "action" : "rerender" "defaultAriaLabel" : "", // just for convenience, you need a login anyways... ] { }, "disableKudosForAnonUser" : "false", "action" : "rerender" }, // If watching, pay attention to key presses, looking for right sequence. ] var do_scroll = sessionStorage.is_scroll; "actions" : [ }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { "actions" : [ "context" : "", { ] "event" : "ProductAnswerComment", { ] "event" : "deleteMessage", { "action" : "addClassName" { ] }, else { "action" : "rerender" $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); }, LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234261}); "displayStyle" : "horizontal", LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "action" : "rerender" "context" : "envParam:quiltName", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "action" : "rerender" "action" : "rerender" ] "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "event" : "QuickReply", ctaHTML += "Lösung noch nicht gefunden? } "event" : "ProductAnswerComment", "event" : "MessagesWidgetEditCommentForm", "initiatorDataMatcher" : "data-lia-kudos-id" { count = 0; "message" : "1969612", "context" : "envParam:quiltName,message", "useTruncatedSubject" : "true", }, "event" : "RevokeSolutionAction", Bist du sicher, dass du fortfahren möchtest? "kudosable" : "true", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1969617,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. $(document).ready(function(){ "actions" : [ }, "actions" : [ "context" : "", } { { { "event" : "addThreadUserEmailSubscription", { }, { LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"};